PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV22141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NF-YA
Protein Properties Length: 292aa    MW: 32122.3 Da    PI: 7.0447
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV22141.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.59.6e-33165221158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++I++RRq+Rak+e ekk+ +ksrkpylheSRh+hAlrR+RgsgGrF
  KZV22141.1 165 EEPVYVNAKQYHGIMRRRQSRAKAELEKKM-IKSRKPYLHESRHQHALRRERGSGGRF 221
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.3E-36163224IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.82164224IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.9E-28166221IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-24167189IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860169189IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.6E-24198221IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MQPNPKSVNQ VESKLCNVGN SNVCSEPWWN NGGSTSFSRG MIRDKASDSS SLEQSADGHS  60
QSEGGVNEED DDAVKHSPSI ISLQEDANYR HMENFQPVAP SLHQGNDGSL THPQQLELVG  120
HSIGCASNPY DPYFGGMVAA YGQPLVPHLY DIHNTRMPLP LEMTEEPVYV NAKQYHGIMR  180
RRQSRAKAEL EKKMIKSRKP YLHESRHQHA LRRERGSGGR FAKKTNADTS KGPDTGSAPT  240
SQSLSGSGSD PFLSQSSRGN APESLQEPAY QHQSGEVREQ PHFGPTVGTY RI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-21164237174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090025.11e-133PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011090024.11e-133PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
SwissprotQ9LXV53e-52NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA5PGU31e-120A5PGU3_ANTMA; YA4
STRINGSolyc11g065700.1.15e-99(Solanum lycopersicum)
STRINGPGSC0003DMT4000277858e-99(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-53nuclear factor Y, subunit A1